PDB entry 1bv7

View 1bv7 on RCSB PDB site
Description: counteracting hiv-1 protease drug resistance: structural analysis of mutant proteases complexed with xv638 and sd146, cyclic urea amides with broad specificities
Class: hydrolase
Keywords: hydrolase(acid proteinase), hydrolase
Deposited on 1998-09-22, released 1998-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hiv-1 protease)
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04585 (0-98)
      • engineered (81)
    Domains in SCOPe 2.08: d1bv7a_
  • Chain 'B':
    Compound: protein (hiv-1 protease)
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04585 (0-98)
      • engineered (81)
    Domains in SCOPe 2.08: d1bv7b_
  • Heterogens: XV6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bv7A (A:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpfniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bv7B (B:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpfniigrnlltqigctlnf