PDB entry 1bv6

View 1bv6 on RCSB PDB site
Description: crystal structure of fixl heme domain
Class: oxygen storage/transport
Keywords: fixl, heme, histidine kinase, signal transduction
Deposited on 1998-09-22, released 1998-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2000-01-24, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.199
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (histidine kinase)
    Species: BRADYRHIZOBIUM JAPONICUM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bv6a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bv6A (A:)
    rethlrsilhtipdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrh
    dsyisryrttsdphiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehq
    qtqarlqelq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bv6A (A:)
    ipdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrtts
    dphiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqelq