PDB entry 1bv4

View 1bv4 on RCSB PDB site
Description: apo-mannose-binding protein-c
Class: sugar binding protein
Keywords: c-type lectin, calcium-binding protein, collectin, sugar binding protein
Deposited on 1998-09-22, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.212
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (mannose-binding protein-c)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bv4a_
  • Chain 'B':
    Compound: protein (mannose-binding protein-c)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bv4b_
  • Chain 'C':
    Compound: protein (mannose-binding protein-c)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bv4c_
  • Chain 'D':
    Compound: protein (mannose-binding protein-c)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bv4d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bv4A (A:)
    senvgkkyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqr
    tenvfedltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bv4A (A:)
    kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvfe
    dltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefsd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bv4B (B:)
    senvgkkyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqr
    tenvfedltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bv4B (B:)
    kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtvfedl
    tgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefsd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bv4C (C:)
    senvgkkyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqr
    tenvfedltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bv4C (C:)
    kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgiedltgcvvll
    tngkwndvpcsdsflvvcefs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bv4D (D:)
    senvgkkyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqr
    tenvfedltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bv4D (D:)
    kkyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvf
    edltgnrvrytnwnegepnnencvvlltngkwndvpcsdsflvvcefsd