PDB entry 1bv2

View 1bv2 on RCSB PDB site
Description: lipid transfer protein from rice seeds, nmr, 14 structures
Class: lipid-binding protein
Keywords: lipid-binding protein, lipid transfer protein, rice, molecular modeling, nmr
Deposited on 1998-09-21, released 1999-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nonspecific lipid transfer protein
    Species: Oryza sativa [TaxId:4530]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23096 (0-90)
      • see remark 999 (34)
    Domains in SCOPe 2.08: d1bv2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bv2A (A:)
    itcgqvnsavgpcltyarggagpsaaccsgvrslkaaasttadrrtacnclknaargikg
    lnagnaasipskcgvsvpytisasidcsrvs