PDB entry 1buz

View 1buz on RCSB PDB site
Description: solution structure of spoiiaa, a phosphorylatable component of the system that regulates transcription factor sigma-f of bacillus subtilis nmr, minimized average structure
Class: transcription regulator
Keywords: transcription regulator, kinase substrate, anti-anti sigma factor, novel alpha/beta fold, sporulation, phosphorylation
Deposited on 1997-09-08, released 1998-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: spoiiaa
  Species: Bacillus subtilis [TaxId:1423]
  Gene: SPOIIAA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10727 (0-115)
  Domains in SCOPe 2.08: d1buza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1buzA (A:)
  slgidmnvkesvlcirltgeldhhtaetlkqkvtqslekddirhivlnledlsfmdssgl
  gvilgrykqikqiggemvvcaispavkrlfdmsglfkiirfeqseqqalltlgvas