PDB entry 1buy

View 1buy on RCSB PDB site
Description: human erythropoietin, nmr minimized average structure
Deposited on 1998-09-08, released 1999-09-10
The last revision prior to the SCOP 1.55 freeze date was dated 1999-09-10, with a file datestamp of 1999-09-09.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1buya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1buyA (A:)
    apprlicdsrvlerylleakeaekittgcaehcslnekitvpdtkvnfyawkrmevgqqa
    vevwqglallseavlrgqallvkssqpweplqlhvdkavsglrslttllralgaqkeais
    ppdaasaaplrtitadtfrklfrvysnflrgklklytgeacrtgdr