PDB entry 1buy

View 1buy on RCSB PDB site
Description: human erythropoietin, nmr minimized average structure
Class: cytokine
Keywords: cytokine, glycoprotein, growth factor
Deposited on 1998-09-08, released 1999-09-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (erythropoietin)
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01588 (0-165)
      • engineered (23)
      • engineered (37)
      • engineered (82)
    Domains in SCOPe 2.08: d1buya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1buyA (A:)
apprlicdsrvlerylleakeaekittgcaehcslnekitvpdtkvnfyawkrmevgqqa
vevwqglallseavlrgqallvkssqpweplqlhvdkavsglrslttllralgaqkeais
ppdaasaaplrtitadtfrklfrvysnflrgklklytgeacrtgdr