PDB entry 1buv

View 1buv on RCSB PDB site
Description: crystal structure of the mt1-mmp-timp-2 complex
Class: hydrolase/hydrolase inhibitor
Keywords: matrix metalloproteinase, tissue inhibitor of metalloproteinases, proteinase complex, pro-gelatinase a activator, crystal structure, hydrolase/hydrolase inhibitor complex
Deposited on 1998-09-07, released 1999-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.189
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: protein (membrane-type matrix metalloproteinase (cdmt1-mmp))
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1buvm_
  • Chain 'T':
    Compound: protein (metalloproteinase inhibitor (timp-2))
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1buvt_
  • Heterogens: CA, ZN

PDB Chain Sequences:

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1buvM (M:)
    iqglkwqhneitfciqnytpkvgeyatyeairkafrvwesatplrfrevpyayireghek
    qadimiffaegfhgdstpfdgeggflahayfpgpniggdthfdsaepwtvrnedlngndi
    flvavhelghalglehssdpsaimapfyqwmdtenfvlpdddrrgiqqlygges
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1buvT (T:)
    cscspvhpqqafcnadivirakavnkkevdsgndiygnpikriqyeikqikmfkgpdqdi
    efiytapaaavcgvsldiggkkeyliagkaegngnmhitlcdfivpwdtlsatqkkslnh
    ryqmgceckitrcpmipcyisspdeclwmdwvtekninghqakffacikrsdgscawyrg
    aapp