PDB entry 1buu

View 1buu on RCSB PDB site
Description: one ho3+ form of rat mannose-binding protein a
Class: sugar binding protein
Keywords: lectin, host defense, metalloprotein, sugar binding protein
Deposited on 1998-09-06, released 1998-09-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (mannose-binding protein a)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1buua1, d1buua2
  • Heterogens: HO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1buuA (A:)
    aievsqgpkgqkgdrgdsraievklanmeaeintlkskleltnklhafsmgkksgkkffv
    tnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtg
    grltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1buuA (A:)
    aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
    gtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtggrltysnwkkdepndhgsg
    edcvtivdnglwndiscqashtavcefpa