PDB entry 1bus

View 1bus on RCSB PDB site
Description: solution conformation of proteinase inhibitor iia from bull seminal plasma by 1h nuclear magnetic resonance and distance geometry
Deposited on 1990-05-14, released 1991-04-15
The last revision prior to the SCOP 1.57 freeze date was dated 1991-07-15, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1bus__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bus_ (-)
    egaqvdcaefkdpkvyctresnphcgsngetygnkcafckavmksggkinlkhrgkc