PDB entry 1bus

View 1bus on RCSB PDB site
Description: solution conformation of proteinase inhibitor iia from bull seminal plasma by 1h nuclear magnetic resonance and distance geometry
Class: proteinase inhibitor
Keywords: proteinase inhibitor
Deposited on 1990-05-14, released 1991-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proteinase inhibitor iia
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1busa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1busA (A:)
    egaqvdcaefkdpkvyctresnphcgsngetygnkcafckavmksggkinlkhrgkc