PDB entry 1buq

View 1buq on RCSB PDB site
Description: solution structure of delta-5-3-ketosteroid isomerase complexed with the steroid 19-nortestosterone-hemisuccinate
Class: isomerase
Keywords: ketosteroid isomerase-19nths, enzyme-substrate complex, enzymes, isomerase
Deposited on 1998-09-04, released 1999-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (3-ketosteroid isomerase-19-nortestosterone-hemisuccinate)
    Species: Comamonas testosteroni [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947
      • engineered (54)
      • engineered (87)
    Domains in SCOPe 2.07: d1buqa_
  • Chain 'B':
    Compound: protein (3-ketosteroid isomerase-19-nortestosterone-hemisuccinate)
    Species: Comamonas testosteroni [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947 (0-124)
      • engineered (54)
      • engineered (87)
    Domains in SCOPe 2.07: d1buqb_
  • Heterogens: NTH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1buqA (A:)
    mntpehmtavvqryvaalnagdldgivalfaddatvedpvgseprsgtaaireffanslk
    lplaveltqevravaneaafaftvsfefqgrktvvapidhfrfngagkvvsmralfgekn
    ihaga
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1buqB (B:)
    mntpehmtavvqryvaalnagdldgivalfaddatvedpvgseprsgtaaireffanslk
    lplaveltqevravaneaafaftvsfefqgrktvvapidhfrfngagkvvsmralfgekn
    ihaga