PDB entry 1buo

View 1buo on RCSB PDB site
Description: btb domain from plzf
Deposited on 1998-09-04, released 1998-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.212
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1buoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1buoA (A:)
    mgmiqlqnpshptgllckanqmrlagtlcdvvimvdsqefhahrtvlactskmfeilfhr
    nsqhytldflspktfqqileyaytatlqakaedlddllyaaeileieyleeqclkmleti
    q