PDB entry 1bun

View 1bun on RCSB PDB site
Description: structure of beta2-bungarotoxin: potassium channel binding by kunitz modules and targeted phospholipase action
Deposited on 1995-10-15, released 1996-04-03
The last revision prior to the SCOP 1.67 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.193
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1buna_
  • Chain 'B':
    Domains in SCOP 1.67: d1bunb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bunA (A:)
    nlinfmemirytipcektwgeyadygcycgaggsgrpidaldrccyvhdncygdaekkhk
    cnpktqsysykltkrtiicygaagtcarivcdcdrtaalcfgnseyieghknidtarfcq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bunB (B:)
    rkrhpdcdkppdtkicqtvvrafyykpsakrcvqfryggcngngnhfksdhlcrcecley
    r