PDB entry 1bun

View 1bun on RCSB PDB site
Description: structure of beta2-bungarotoxin: potassium channel binding by kunitz modules and targeted phospholipase action
Class: toxin
Keywords: hydrolase, presynaptic neurotoxin
Deposited on 1995-10-15, released 1996-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.193
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta2-bungarotoxin
  Species: Bungarus multicinctus [TaxId:8616]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00617 (0-119)
    • conflict (65-66)
    • conflict (86)
    • conflict (102)
    • conflict (104)
  Domains in SCOPe 2.08: d1buna_
• Chain 'B':
  Compound: beta2-bungarotoxin
  Species: Bungarus multicinctus [TaxId:8616]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00989 (0-60)
  Domains in SCOPe 2.08: d1bunb_
• Heterogens: NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bunA (A:)
  nlinfmemirytipcektwgeyadygcycgaggsgrpidaldrccyvhdncygdaekkhk
  cnpktqsysykltkrtiicygaagtcarivcdcdrtaalcfgnseyieghknidtarfcq
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bunB (B:)
  rkrhpdcdkppdtkicqtvvrafyykpsakrcvqfryggcngngnhfksdhlcrcecley
  r