PDB entry 1bun

View 1bun on RCSB PDB site
Description: structure of beta2-bungarotoxin: potassium channel binding by kunitz modules and targeted phospholipase action
Class: toxin
Keywords: hydrolase, presynaptic neurotoxin
Deposited on 1995-10-15, released 1996-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.193
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta2-bungarotoxin
    Species: Bungarus multicinctus [TaxId:8616]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00617 (0-119)
      • conflict (65-66)
      • conflict (86)
      • conflict (102)
      • conflict (104)
    Domains in SCOPe 2.08: d1buna_
  • Chain 'B':
    Compound: beta2-bungarotoxin
    Species: Bungarus multicinctus [TaxId:8616]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bunb_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bunA (A:)
    nlinfmemirytipcektwgeyadygcycgaggsgrpidaldrccyvhdncygdaekkhk
    cnpktqsysykltkrtiicygaagtcarivcdcdrtaalcfgnseyieghknidtarfcq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bunB (B:)
    rkrhpdcdkppdtkicqtvvrafyykpsakrcvqfryggcngngnhfksdhlcrcecley
    r