PDB entry 1bul

View 1bul on RCSB PDB site
Description: 6alpha-(hydroxypropyl)penicillanate acylated on nmc-a beta-lactamase from enterobacter cloacae
Class: hydrolase
Keywords: hydrolase, antibiotic resistance, class a carbapenemase
Deposited on 1998-09-04, released 1998-12-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.209
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nmc-a beta-lactamase
    Species: Enterobacter cloacae [TaxId:550]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bula_
  • Heterogens: AP3, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bulA (A:)
    ntkgideiknletdfngrigvyaldtgsgksfsyranerfplcssfkgflaaavlkgsqd
    nrlnlnqivnyntrslefhspittkykdngmslgdmaaaalqysdngatniileryiggp
    egmtkfmrsigdedfrldrweldlntaipgderdtstpaavakslktlalgnilseheke
    tyqtwlkgnttgaarirasvpsdwvvgdktgscgaygtandyavvwpknrapliisvytt
    knekeakhedkviaeasriaidnlk