PDB entry 1buk

View 1buk on RCSB PDB site
Description: r337a mutant of pyruvate phosphate dikinase
Deposited on 1998-09-03, released 1998-09-09
The last revision was dated 1999-09-13, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.185
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence, based on SEQRES records:
    >1buk_ (-)
    makwvykfeegnasmrnllggkgcnlaemtilgmpipqgftvtteacteyynsgkqitqe
    iqdqifeaitwleelngkkfgdtedpllvsvrsaarasmpgmmdtilnlglndvavegfa
    kktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkela
    ekfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvq
    tmvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpd
    cykqfmdlamklekhfrdmqdmeftieegklyflqtangkrtapaalqiacdlvdegmit
    eeeavvrieaksldqllhptfnpaalkagevigsalpaspgaaagkvyftadeakaahek
    gervilvrletspediegmhaaegiltvrggmtshaavvargmgtccvsgcgeikineea
    ktfelgghtfaegdyisldgstgkiykgdietqeasvsgsferimvwadkfrtlkvrtna
    dtpedtlnavklgaegiglcrtehmffeadrimkirkmilsdsveareealnelipfqkg
    dfkamykalegrpmtvryldpplhefvphteeeqaelaknmgltlaevkakvdelhefnp
    mmghrgcrlavtypeiakmqtravmeaaievkeetgidivpeimiplvgekkelkfvkdv
    vvevaeqvkkekgsdmqyhigtmieipraaltadaiaeeaeffsfgtndltqmtfgfsrd
    dagkfldsyykakiyesdpfarldqtgvgqlvemavkkgrqtrpglkcgicgehggdpss
    vefchkvglnyvscspfrvpiarlaaaqaalnnk
    

    Sequence, based on observed residues (ATOM records):
    >1buk_ (-)
    akwvykfeegnasmrnllggkgcnlaemtilgmpipqgftvtteacteyynsgkqitqei
    qdqifeaitwleelngkkfgdtedpllvsvrsaarasmpgmmdtilnlglndvavegfak
    ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae
    kfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvqt
    mvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpdc
    ykqfmdlamklekhfrdmqdmeftieegklyflqtangkrtapaalqiacdlvdegmite
    eeavvrieaksldqllhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekg
    ervilvrletspediegmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeak
    tfelgghtfaegdyisldgstgkiietqeasvsgsferimvwadkfrtlkvrtnadtped
    tlnavklgaegiglcrtehmffeadrimkirkmilsdsveareealnelipfqkgdfkam
    ykalegrpmtvryldpplhefvphteeeqaelaknmgltlaevkakvdelhefnpmmghr
    gcrlavtypeiakmqtravmeaaievkeetgidivpeimiplvgekkelkfvkdvvveva
    eqvkkekgsdmqyhigtmieipraaltadaiaeeaeffsfgtndltqmtfgfsrddagkf
    ldsyykakiyesdpfarldqtgvgqlvemavkkgrqtrpglkcgicgehggdpssvefch
    kvglnyvscspfrvpiarlaaaqaalnnk
    

  • Chain 'p':
    No sequence available.