PDB entry 1buj

View 1buj on RCSB PDB site
Description: structure of binase in solution
Class: hydrolase
Keywords: microbial ribonuclease, hydrolase
Deposited on 1998-09-04, released 1998-09-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (binase)
  Species: Bacillus intermedius [TaxId:1400]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00649 (0-108)
  Domains in SCOPe 2.08: d1buja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bujA (A:)
  avintfdgvadylirykrlpdnyitksqasalgwvaskgnlaevapgksiggdvfsnreg
  rlpsasgrtwreadinyvsgfrnadrlvyssdwliykttdhyatftrir