PDB entry 1buj

View 1buj on RCSB PDB site
Description: structure of binase in solution
Class: hydrolase
Keywords: microbial ribonuclease, hydrolase
Deposited on 1998-09-04, released 1998-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (binase)
    Species: Bacillus intermedius [TaxId:1400]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1buja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bujA (A:)
    avintfdgvadylirykrlpdnyitksqasalgwvaskgnlaevapgksiggdvfsnreg
    rlpsasgrtwreadinyvsgfrnadrlvyssdwliykttdhyatftrir