PDB entry 1bug

View 1bug on RCSB PDB site
Description: catechol oxidase from ipomoea batatas (sweet potatoes)-inhibitor complex with phenylthiourea (ptu)
Class: oxidoreductase
Keywords: catechol oxidase, dicopper enzyme, ipomoea batatas, oxidoreductase
Deposited on 1998-09-03, released 1999-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.181
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (catechol oxidase)
    Species: Ipomoea batatas [TaxId:4120]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1buga_
  • Chain 'B':
    Compound: protein (catechol oxidase)
    Species: Ipomoea batatas [TaxId:4120]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bugb_
  • Heterogens: CU, URS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bugA (A:)
    apiqapeiskcvvppadlppgavvdnccppvasnivdyklpavttmkvrpaahtmdkdai
    akfakavelmkalpaddprnfyqqalvhcaycnggydqvnfpdqeiqvhnswlffpfhrw
    ylyfyerilgkligdpsfglpfwnwdnpggmvlpdflndstsslydsnrnqshlppvvvd
    lgyngadtdvtdqqritdnlalmykqmvtnagtaelflgkayragdapspgagsietsph
    ipihrwvgdprntnnedmgnfysagrdiafychhsnvdrmwtiwqqlagkprkrdytdsd
    wlnatflfydengqavkvrigdsldnqkmgykyaktplpwldskp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bugA (A:)
    apiqapeiskcvvppadlppgavvdnccppvasnivdyklpavttmkvrpaahtmdkdai
    akfakavelmkalpaddprnfyqqalvhcaycnggydqvnfpdqeiqvhnswlffpfhrw
    ylyfyerilgkligdpsfglpfwnwdnpggmvlpdflndstsslydsnrnqshlppvvvd
    lgyngadtdvtdqqritdnlalmykqmvtnagtaelflgkayragdapspgagsietsph
    ipihrwvgdprntnnedmgnfysagrdiafychhsnvdrmwtiwqqlardytdsdwlnat
    flfydengqavkvrigdsldnqkmgykyaktplpwl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bugB (B:)
    apiqapeiskcvvppadlppgavvdnccppvasnivdyklpavttmkvrpaahtmdkdai
    akfakavelmkalpaddprnfyqqalvhcaycnggydqvnfpdqeiqvhnswlffpfhrw
    ylyfyerilgkligdpsfglpfwnwdnpggmvlpdflndstsslydsnrnqshlppvvvd
    lgyngadtdvtdqqritdnlalmykqmvtnagtaelflgkayragdapspgagsietsph
    ipihrwvgdprntnnedmgnfysagrdiafychhsnvdrmwtiwqqlagkprkrdytdsd
    wlnatflfydengqavkvrigdsldnqkmgykyaktplpwldskp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bugB (B:)
    apiqapeiskcvvppadlppgavvdnccppvasnivdyklpavttmkvrpaahtmdkdai
    akfakavelmkalpaddprnfyqqalvhcaycnggydqvnfpdqeiqvhnswlffpfhrw
    ylyfyerilgkligdpsfglpfwnwdnpggmvlpdflndstsslydsnrnqshlppvvvd
    lgyngadtdvtdqqritdnlalmykqmvtnagtaelflgkayragdapspgagsietsph
    ipihrwvgdprntnnedmgnfysagrdiafychhsnvdrmwtiwqqlardytdsdwlnat
    flfydengqavkvrigdsldnqkmgykyaktplpwl