PDB entry 1bud

View 1bud on RCSB PDB site
Description: acutolysin a from snake venom of agkistrodon acutus at ph 5.0
Deposited on 1998-09-03, released 1999-09-07
The last revision prior to the SCOP 1.71 freeze date was dated 2003-09-23, with a file datestamp of 2003-09-23.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.169
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1buda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1budA (A:)
    fqrymeivivvdhsmvkkyngdsdsikawvyemintitesysylkidislsgleiwsgkd
    lidveasagntlksfgewrakdlihrishdnaqlltatdfdgatiglayvasmcnpkrsv
    gviqdhssvnrlvaitlahemahnlgvshdegscscggkscimspsisdetikyfsdcsy
    iqcrdyiskenppciln