PDB entry 1bud

View 1bud on RCSB PDB site
Description: acutolysin a from snake venom of agkistrodon acutus at ph 5.0
Deposited on 1998-09-03, released 1999-09-07
The last revision prior to the SCOP 1.61 freeze date was dated 1999-09-07, with a file datestamp of 1999-09-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.169
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1buda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1budA (A:)
fqrymeivivvdhsmvkkyngdsdsikawvyemintitesysylkidislsgleiwsgkd
lidveasagntlksfgewrakdlihrishdnaqlltatdfdgatiglayvasmcnpkrsv
gviqdhssvnrlvaitlahemahnlgvshdegscscggkscimspsisdetikyfsdcsy
iqcrdyiskenppciln