PDB entry 1bud

View 1bud on RCSB PDB site
Description: acutolysin a from snake venom of agkistrodon acutus at ph 5.0
Class: toxin
Keywords: metalloproteinase, snake venom, mmp, toxin
Deposited on 1998-09-03, released 1999-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (acutolysin a)
    Species: Deinagkistrodon acutus [TaxId:36307]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9PW35 (0-196)
      • conflict (24)
      • conflict (44)
      • conflict (48)
      • conflict (57)
      • conflict (62)
      • conflict (65)
      • conflict (68)
      • conflict (102)
      • conflict (114)
      • conflict (122)
      • conflict (147)
      • conflict (158-159)
      • conflict (165)
      • conflict (167-168)
      • conflict (170)
      • conflict (184)
    Domains in SCOPe 2.08: d1buda_
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1budA (A:)
    fqrymeivivvdhsmvkkyngdsdsikawvyemintitesysylkidislsgleiwsgkd
    lidveasagntlksfgewrakdlihrishdnaqlltatdfdgatiglayvasmcnpkrsv
    gviqdhssvnrlvaitlahemahnlgvshdegscscggkscimspsisdetikyfsdcsy
    iqcrdyiskenppciln