PDB entry 1bua

View 1bua on RCSB PDB site
Description: structural and energetic origins of indirect readout in site-specific DNA cleavage by a restriction endonuclease
Class: hydrolase/DNA
Keywords: ENDONUCLEASE ECORV (E.C.3.1.21.4)/DNA COMPLEX, hydrolase/DNA COMPLEX
Deposited on 1998-09-03, released 1998-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.2
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endonuclease ecorv
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1buaa_
  • Chain 'B':
    Compound: endonuclease ecorv
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1buab_
  • Chain 'C':
    Compound: DNA (5'-d(*ap*ap*ap*gp*ap*cp*ip*tp*cp*tp*t)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*ap*ap*ap*gp*ap*cp*ip*tp*cp*tp*t)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1buaA (A:)
    slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
    iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
    vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
    gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
    rgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1buaA (A:)
    slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
    iveepqqnhypdftlykpsepnkkiaidikttytekikftlggytsfirnntknivypfd
    qyiahwiigyvytrvktyninelneipkpykgvkvflqdkwviagdlagsgnttnigsih
    ahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiyrgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1buaB (B:)
    slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
    iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
    vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
    gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
    rgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1buaB (B:)
    slrsdlinalydedvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgyivee
    pkqqnhypdftlykpsepnkkiaidikttytnkikftlggytsfirnntknivypfdqyi
    ahwiigyvytrslktyninelneipkpykgvkvflqdkwviagdlagsgnttnigsihah
    ykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiyrgr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.