PDB entry 1bu9

View 1bu9 on RCSB PDB site
Description: solution structure of p18-ink4c, 21 structures
Class: hormone/growth factor
Keywords: cell cycle inhibitor, p18ink4c, tumor, suppressor, cyclin-dependent kinase, hormone/growth factor complex
Deposited on 1998-09-15, released 1999-09-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (cyclin-dependent kinase 6 inhibitor)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P42773 (0-167)
  Domains in SCOPe 2.08: d1bu9a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bu9A (A:)
  maepwgnelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgnpeiarrlllrg
  anpdlkdrtgfavihdaaragfldtlqtllefqadvniednegnlplhlaakeghlrvve
  flvkhtasnvghrnhkgdtacdlarlygrnevvslmqangaggatnlq