PDB entry 1bu8

View 1bu8 on RCSB PDB site
Description: rat pancreatic lipase related protein 2
Deposited on 1998-09-14, released 1998-12-23
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.202
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bu8A (A:)
    kevcyghlgcfsndkpwagmlqrplkifpwspedidtrfllytnenpnnyqkisatepdt
    ikfsnfqldrktrfivhgfidkgedgwlldmckkmfqvekvncicvdwrrgsrteytqas
    yntrvvgaeiaflvqvlstemgyspenvhlighslgahvvgeagrrleghvgritgldpa
    epcfqglpeevrldpsdamfvdvihtdsapiipylgfgmsqkvghldffpnggkempgcq
    knilstivdingiwegtqnfvacnhlrsykyyassilnpdgflgypcssyekfqqndcfp
    cpeegcpkmghyadqfegktatveqtvylntgdsgnftrwrykvsvtlsgakklsgyilv
    alygnngnskqyeifkgslkpearhvrdidvdinvgeiqkvkflwnnkvinlfrptlgas
    qitvqsgvdgkeynfcssdtvredvlqslypc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bu8A (A:)
    kevcyghlgcfsndkpwagmlqrplkifpwspedidtrfllytnenpnnyqkisatepdt
    ikfsnfqldrktrfivhgfidkgedgwlldmckkmfqvekvncicvdwrrgsrteytqas
    yntrvvgaeiaflvqvlstemgyspenvhlighslgahvvgeagrrleghvgritgldpa
    epcfqglpeevrldpsdamfvdvihtdsapiipylgfgmsqkvghldffpnggkempgcq
    knilstivdingiwegtqnfvacnhlrsykyyassilnpdgflgypcssyekfqqndcfp
    cpeegcpkmghyadqfegktatveqtvylntgdsgnftrwrykvsvtlsgakklsgyilv
    alygnngnskqyeifkgslkpearhvrdidvdinvgeiqkvkflwnnrptlgasqitvqs
    gvdgkeynfcssdtvredvlqslypc