PDB entry 1bu8

View 1bu8 on RCSB PDB site
Description: rat pancreatic lipase related protein 2
Class: hydrolase
Keywords: hydrolase, lipid degradation, pancreatic lipase
Deposited on 1998-09-14, released 1998-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.202
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (pancreatic lipase related protein 2)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bu8a1, d1bu8a2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bu8A (A:)
    kevcyghlgcfsndkpwagmlqrplkifpwspedidtrfllytnenpnnyqkisatepdt
    ikfsnfqldrktrfivhgfidkgedgwlldmckkmfqvekvncicvdwrrgsrteytqas
    yntrvvgaeiaflvqvlstemgyspenvhlighslgahvvgeagrrleghvgritgldpa
    epcfqglpeevrldpsdamfvdvihtdsapiipylgfgmsqkvghldffpnggkempgcq
    knilstivdingiwegtqnfvacnhlrsykyyassilnpdgflgypcssyekfqqndcfp
    cpeegcpkmghyadqfegktatveqtvylntgdsgnftrwrykvsvtlsgakklsgyilv
    alygnngnskqyeifkgslkpearhvrdidvdinvgeiqkvkflwnnkvinlfrptlgas
    qitvqsgvdgkeynfcssdtvredvlqslypc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bu8A (A:)
    kevcyghlgcfsndkpwagmlqrplkifpwspedidtrfllytnenpnnyqkisatepdt
    ikfsnfqldrktrfivhgfidkgedgwlldmckkmfqvekvncicvdwrrgsrteytqas
    yntrvvgaeiaflvqvlstemgyspenvhlighslgahvvgeagrrleghvgritgldpa
    epcfqglpeevrldpsdamfvdvihtdsapiipylgfgmsqkvghldffpnggkempgcq
    knilstivdingiwegtqnfvacnhlrsykyyassilnpdgflgypcssyekfqqndcfp
    cpeegcpkmghyadqfegktatveqtvylntgdsgnftrwrykvsvtlsgakklsgyilv
    alygnngnskqyeifkgslkpearhvrdidvdinvgeiqkvkflwnnrptlgasqitvqs
    gvdgkeynfcssdtvredvlqslypc