PDB entry 1bu5

View 1bu5 on RCSB PDB site
Description: x-ray crystal structure of the desulfovibrio vulgaris (hildenborough) apoflavodoxin-riboflavin complex
Class: electron transport
Keywords: flavoprotein, electron transport
Deposited on 1998-09-12, released 1999-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.169
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (flavodoxin)
    Species: Desulfovibrio vulgaris [TaxId:881]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00323 (0-146)
    • PDB 1BU5 (0-146)
    Domains in SCOPe 2.07: d1bu5a_
  • Chain 'B':
    Compound: protein (flavodoxin)
    Species: Desulfovibrio vulgaris [TaxId:881]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00323 (0-146)
    • PDB 1BU5 (0-146)
    Domains in SCOPe 2.07: d1bu5b_
  • Heterogens: SO4, RBF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bu5A (A:)
    pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
    ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
    dglridgdpraarddivgwahdvrgai
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bu5B (B:)
    pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
    ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
    dglridgdpraarddivgwahdvrgai