PDB entry 1bu4

View 1bu4 on RCSB PDB site
Description: ribonuclease 1 complex with 2'gmp
Deposited on 1998-09-11, released 1999-02-16
The last revision prior to the SCOP 1.55 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.185
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1bu4__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bu4_ (-)
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect