PDB entry 1bu4

View 1bu4 on RCSB PDB site
Description: ribonuclease 1 complex with 2'gmp
Class: endoribonuclease
Keywords: hydrolase, endoribonuclease
Deposited on 1998-09-11, released 1999-02-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.185
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease t1
    Species: Aspergillus oryzae [TaxId:5062]
    Gene: synthetic gene
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00651 (0-103)
      • conflict (24)
    Domains in SCOPe 2.08: d1bu4a_
  • Heterogens: CA, 2GP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bu4A (A:)
acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect