PDB entry 1bu2

View 1bu2 on RCSB PDB site
Description: x-ray structure of a viral cyclin from herpesvirus saimiri
Class: cell cycle regulation
Keywords: cell cycle regulation, herpesvirus saimiri, viral cyclin
Deposited on 1998-09-10, released 1999-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.242
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin homolog
    Species: Herpesvirus saimiri (strain 11) [TaxId:10383]
    Gene: ECLF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bu2a1, d1bu2a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bu2A (A:)
rvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfeldksvfplsvsild
rylckkqgtkktlqkigaacvligskirtvkpmtvskltylscdcftnlelinqekdile
alkwdteavlatdfliplcnalkipedlwpqlyeaasttickaliqpniallspglicag
gllttietdntncrpwtcyledlssilnfstntvrtvkdqvseafslyd