PDB entry 1bty

View 1bty on RCSB PDB site
Description: Crystal structure of beta-trypsin in complex with benzamidine
Class: hydrolase
Keywords: benzamidine inhibited, hydrolase (serine proteinase), hydrolase
Deposited on 1995-05-17, released 1995-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.161
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-trypsin
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1btya_
  • Heterogens: CA, BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1btyA (A:)
    vddddkivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedn
    invvegneqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagt
    qclisgwgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscq
    gdsggpvvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1btyA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn