PDB entry 1btn

View 1btn on RCSB PDB site
Description: structure of the binding site for inositol phosphates in a ph domain
Class: signal transduction protein
Keywords: signal transduction protein
Deposited on 1995-08-23, released 1996-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-spectrin
    Species: Mus musculus [TaxId:10090]
    Gene: MUSSPNA.GBROD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1btna_
  • Heterogens: I3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1btnA (A:)
megflnrkheweahnkkassrswhnvycvinnqemgfykdaksaasgipyhsevpvslke
aicevaldykkkkhvfklrlsdgneylfqakddeemntwiqaissa