PDB entry 1btm

View 1btm on RCSB PDB site
Description: triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid
Class: isomerase
Keywords: isomerase
Deposited on 1995-11-11, released 1996-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.176
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1btma_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1btmb_
  • Heterogens: PGA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1btmA (A:)
    rkpiiagnwkmhktlaeavqfvedvkghvppadevisvvcapflfldrlvqaadgtdlki
    gaqtmhfadqgaytgevspvmlkdlgvtyvilghserrqmfaetdetvnkkvlaaftrgl
    ipiiccgesleereagqtnavvasqvekalagltpeqvkqaviayepiwaigtgksstpe
    dansvcghirsvvsrlfgpeaaeairiqyggsvkpdnirdflaqqqidgplvggaslepa
    sflqlveagrhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1btmA (A:)
    rkpiiagnwkmhktlaeavqfvedvkghvppadevisvvcapflfldrlvqaadgtdlki
    gaqtmhfadqgaytgevspvmlkdlgvtyvilghserrqmfaetdetvnkkvlaaftrgl
    ipiiccgesleereagqtnavvasqvekalagltpeqvkqaviayepiwaigtgksstpe
    dansvcghirsvvsrlfgpeaaeairiqyggsvkpdnirdflaqqqidgplvggaslepa
    sflqlveagrh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1btmB (B:)
    rkpiiagnwkmhktlaeavqfvedvkghvppadevisvvcapflfldrlvqaadgtdlki
    gaqtmhfadqgaytgevspvmlkdlgvtyvilghserrqmfaetdetvnkkvlaaftrgl
    ipiiccgesleereagqtnavvasqvekalagltpeqvkqaviayepiwaigtgksstpe
    dansvcghirsvvsrlfgpeaaeairiqyggsvkpdnirdflaqqqidgplvggaslepa
    sflqlveagrhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1btmB (B:)
    rkpiiagnwkmhktlaeavqfvedvkghvppadevisvvcapflfldrlvqaadgtdlki
    gaqtmhfadqgaytgevspvmlkdlgvtyvilghserrqmfaetdetvnkkvlaaftrgl
    ipiiccgesleereagqtnavvasqvekalagltpeqvkqaviayepiwaigtgksstpe
    dansvcghirsvvsrlfgpeaaeairiqyggsvkpdnirdflaqqqidgplvggaslepa
    sflqlveagrh