PDB entry 1btm

View 1btm on RCSB PDB site
Description: triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid
Deposited on 1995-11-11, released 1996-04-03
The last revision prior to the SCOP 1.61 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.176
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1btma_
  • Chain 'B':
    Domains in SCOP 1.61: d1btmb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1btmA (A:)
    rkpiiagnwkmhktlaeavqfvedvkghvppadevisvvcapflfldrlvqaadgtdlki
    gaqtmhfadqgaytgevspvmlkdlgvtyvilghserrqmfaetdetvnkkvlaaftrgl
    ipiiccgesleereagqtnavvasqvekalagltpeqvkqaviayepiwaigtgksstpe
    dansvcghirsvvsrlfgpeaaeairiqyggsvkpdnirdflaqqqidgplvggaslepa
    sflqlveagrh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1btmB (B:)
    rkpiiagnwkmhktlaeavqfvedvkghvppadevisvvcapflfldrlvqaadgtdlki
    gaqtmhfadqgaytgevspvmlkdlgvtyvilghserrqmfaetdetvnkkvlaaftrgl
    ipiiccgesleereagqtnavvasqvekalagltpeqvkqaviayepiwaigtgksstpe
    dansvcghirsvvsrlfgpeaaeairiqyggsvkpdnirdflaqqqidgplvggaslepa
    sflqlveagrh