PDB entry 1btk

View 1btk on RCSB PDB site
Description: ph domain and btk motif from bruton's tyrosine kinase mutant r28c
Class: transferase
Keywords: transferase, ph domain, btk motif, zinc binding, x-linked agammaglobulinemia, tyrosine-protein kinase
Deposited on 1997-07-01, released 1997-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.231
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bruton's tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06187 (0-168)
      • engineered (26)
    Domains in SCOPe 2.07: d1btka_
  • Chain 'B':
    Compound: bruton's tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06187 (0-168)
      • engineered (26)
    Domains in SCOPe 2.07: d1btkb_
  • Heterogens: ZN, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1btkA (A:)
    aavilesiflkrsqqkkktsplnfkkclflltvhklsyyeydfergrrgskkgsidveki
    tcvetvvpeknppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelr
    krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1btkA (A:)
    aavilesiflkrsqqkkktsplnfkkclflltvhklsyyeydfergrrgskkgsidveki
    tcvetvvpeknppperqimeqisiierfpypfqvvydegplyvfspteelrkrwihqlkn
    virynsdlvqkyhpcfwidgqylccsqtaknamgcqilen
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1btkB (B:)
    aavilesiflkrsqqkkktsplnfkkclflltvhklsyyeydfergrrgskkgsidveki
    tcvetvvpeknppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelr
    krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen