PDB entry 1btj

View 1btj on RCSB PDB site
Description: human serum transferrin, recombinant n-terminal lobe, apo form, crystal form 2
Class: metal transport
Keywords: iron transport, glycoprotein, transferrin, n-lobe, iron-free form, conformational change, metal transport
Deposited on 1998-09-01, released 1999-01-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.217
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (serum transferrin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1btja_
  • Chain 'B':
    Compound: protein (serum transferrin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1btjb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1btjA (A:)
    vpdktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadav
    tldaglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkscht
    glgrsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcs
    tlnqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykd
    chlaqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsah
    gflkvpprmdakmylgyeyvtairnlregtcpeaptd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1btjA (A:)
    ktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtld
    aglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtglg
    rsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstln
    qyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdchl
    aqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgfl
    kvpprmdakmylgyeyvtairnlregtcpeapt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1btjB (B:)
    vpdktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadav
    tldaglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkscht
    glgrsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcs
    tlnqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykd
    chlaqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsah
    gflkvpprmdakmylgyeyvtairnlregtcpeaptd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1btjB (B:)
    ktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtld
    aglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtglg
    rsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstln
    qyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdchl
    aqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgfl
    kvpprmdakmylgyeyvtairnlregtcpeapt