PDB entry 1bti

View 1bti on RCSB PDB site
Description: crevice-forming mutants in the rigid core of bovine pancreatic trypsin inhibitor: crystal structures of f22a, y23a, n43g, and f45a
Class: serine protease inhibitor
Keywords: serine protease inhibitor
Deposited on 1991-07-11, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.172
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: bovine pancreatic trypsin inhibitor
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00974 (0-57)
    • conflict (21)
  Domains in SCOPe 2.08: d1btia_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1btiA (A:)
  rpdfcleppytgpckariiryaynakaglcqtfvyggcrakrnnfksaedcmrtcgga