PDB entry 1btg

View 1btg on RCSB PDB site
Description: crystal structure of beta nerve growth factor at 2.5 a resolution in c2 space group with zn ions bound
Deposited on 1995-08-29, released 1996-03-08
The last revision prior to the SCOP 1.59 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.179
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1btga_
  • Chain 'B':
    Domains in SCOP 1.59: d1btgb_
  • Chain 'C':
    Domains in SCOP 1.59: d1btgc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1btgA (A:)
    gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
    gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkat
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1btgB (B:)
    gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
    gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkatr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1btgC (C:)
    gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
    gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkatr