PDB entry 1btc

View 1btc on RCSB PDB site
Description: three-dimensional structure of soybean beta-amylase determined at 3.0 angstroms resolution: preliminary chain tracing of the complex with alpha-cyclodextrin
Class: hydrolase(o-glycosyl)
Keywords: hydrolase(o-glycosyl)
Deposited on 1993-02-18, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-amylase
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1btca_
  • Heterogens: GLC, SO4, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1btcA (A:)
    snmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiielkgp
    kqydwrayrslfqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhdifyt
    nrsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievglgpa
    gelrypsypqsqgwefprigefqcydkylkadfkaavaraghpewelpddagkyndvpes
    tgffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgihwwyk
    venhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpqelvq
    qvlsggwredirvagenalprydataynqiilnakpqgvnnngppklsmfgvtylrlsdd
    llqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkptlpfp
    wlpetdmkvdg