PDB entry 1btb

View 1btb on RCSB PDB site
Description: three-dimensional solution structure and 13c assignments of barstar using nuclear magnetic resonance spectroscopy
Deposited on 1994-05-09, released 1994-07-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1btb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1btb_ (-)
    kkavingeqirsisdlhqtlkkelalpeyygenldalwdcltgwveyplvlewrqfeqsk
    qltengaesvlqvfreakaegcditiils