PDB entry 1btb

View 1btb on RCSB PDB site
Description: three-dimensional solution structure and 13c assignments of barstar using nuclear magnetic resonance spectroscopy
Class: ribonuclease inhibitor
Keywords: ribonuclease inhibitor
Deposited on 1994-05-09, released 1994-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: barstar
  Species: Bacillus amyloliquefaciens [TaxId:1390]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11540 (0-88)
  Domains in SCOPe 2.08: d1btba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1btbA (A:)
  kkavingeqirsisdlhqtlkkelalpeyygenldalwdcltgwveyplvlewrqfeqsk
  qltengaesvlqvfreakaegcditiils