PDB entry 1bta

View 1bta on RCSB PDB site
Description: three-dimensional solution structure and 13c assignments of barstar using nuclear magnetic resonance spectroscopy
Deposited on 1994-05-09, released 1994-07-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1bta__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bta_ (-)
  kkavingeqirsisdlhqtlkkelalpeyygenldalwdcltgwveyplvlewrqfeqsk
  qltengaesvlqvfreakaegcditiils