PDB entry 1bt9

View 1bt9 on RCSB PDB site
Description: ompf porin mutant d74a
Class: membrane protein
Keywords: integral membrane protein porin, porin, membrane protein
Deposited on 1998-09-01, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (matrix porin outer membrane protein f)
    Species: Escherichia coli [TaxId:37762]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02931 (0-339)
      • engineered (73)
    Domains in SCOPe 2.07: d1bt9a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bt9A (A:)
    aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
    weynfqgnnsegaaaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
    dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
    eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
    tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
    yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf