PDB entry 1bt7

View 1bt7 on RCSB PDB site
Description: the solution nmr structure of the n-terminal protease domain of the hepatitis c virus (hcv) ns3-protein, from bk strain, 20 structures
Class: hydrolase
Keywords: hydrolase, viral non-structural protein, serine protease
Deposited on 1998-09-01, released 1999-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ns3 serine protease
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26663 (Start-179)
      • conflict (55)
    Domains in SCOPe 2.07: d1bt7a1, d1bt7a2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bt7A (A:)
    apitaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgag
    sktlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrg
    dsrgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettmr
    askkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bt7A (A:)
    tgrdknqvegevqvvstatqsflatcvngvcwtvyhgagsktlagpkgpitqmytnvdqd
    lvgwqappgarsltpctcgssdlylvtrhadvipvrrrgdsrgsllsprpvsylkgssgg
    pllcpsghavgifraavctrgvakavdfvpvesmettmraskkkk