PDB entry 1bt6

View 1bt6 on RCSB PDB site
Description: p11 (s100a10), ligand of annexin ii in complex with annexin ii n-terminus
Deposited on 1998-09-02, released 1999-01-27
The last revision prior to the SCOP 1.55 freeze date was dated 1999-04-20, with a file datestamp of 1999-04-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.233
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bt6a_
  • Chain 'B':
    Domains in SCOP 1.55: d1bt6b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bt6A (A:)
psqmehametmmftfhkfagdkgyltkedlrvlmekefpgflenqkdplavdkimkdldq
crdgkvgfqsffsliagltiacndyfvvhmk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bt6B (B:)
psqmehametmmftfhkfagdkgyltkedlrvlmekefpgflenqkdplavdkimkdldq
crdgkvgfqsffsliagltiacndyfvvhmk