PDB entry 1bt6

View 1bt6 on RCSB PDB site
Description: p11 (s100a10), ligand of annexin II in complex with annexin II n-terminus
Class: complex (ligand/annexin)
Keywords: s100 family, ef-hand protein, complex (ligand/annexin), ligand of annexin II, calcium/phospholipid binding protein
Deposited on 1998-09-02, released 1999-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.233
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s100a10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bt6a_
  • Chain 'B':
    Compound: s100a10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bt6b_
  • Chain 'C':
    Compound: annexin II
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: annexin II
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bt6A (A:)
    psqmehametmmftfhkfagdkgyltkedlrvlmekefpgflenqkdplavdkimkdldq
    crdgkvgfqsffsliagltiacndyfvvhmkqkgkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bt6A (A:)
    psqmehametmmftfhkfagdkgyltkedlrvlmekefpgflenqkdplavdkimkdldq
    crdgkvgfqsffsliagltiacndyfvvhmk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bt6B (B:)
    psqmehametmmftfhkfagdkgyltkedlrvlmekefpgflenqkdplavdkimkdldq
    crdgkvgfqsffsliagltiacndyfvvhmkqkgkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bt6B (B:)
    psqmehametmmftfhkfagdkgyltkedlrvlmekefpgflenqkdplavdkimkdldq
    crdgkvgfqsffsliagltiacndyfvvhmk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.