PDB entry 1bt4

View 1bt4 on RCSB PDB site
Description: phosphoserine aminotransferase from bacillus circulans subsp. alkalophilus
Class: transferase
Keywords: aminotransferase, pyridoxal-5'-phosphate, phosphoserine, alkaliphilic, transferase
Deposited on 1998-09-02, released 1998-09-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.184
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (phosphoserine aminotransferase)
    Species: Bacillus circulans subsp. alkalophilus [TaxId:44160]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59196 (Start-361)
      • expression tag (2)
    Domains in SCOPe 2.06: d1bt4a_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bt4A (A:)
    mseraynfnagpaalplevleraqaefvdyqhtgmsimemshrgavyeavhneaqarlla
    llgnptgykvlfiqggastqfamipmnflkegqtanyvmtgswaskalkeakligdthva
    asseasnymtlpklqeiqlqdnaaylhltsnetiegaqfkafpdtgsvpligdmssdils
    rpfdlnqfglvyagaqknlgpsgvtvvivredlvaespkhlptmlrydtyvknnslyntp
    psfgiymvnevlkwieergglegvqqanrkkasliydaidqsggfyrgcvdvdsrsdmni
    tfrlaseelekefvkaseqegfvglkghrsvgglrasiynavpyescealvqfmehfkrs
    rg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bt4A (A:)
    seraynfnagpaalplevleraqaefvdyqhtgmsimemshrgavyeavhneaqarllal
    lgnptgykvlfiqggastqfamipmnflkegqtanyvmtgswaskalkeakligdthvaa
    sseasnymtlpklqeiqlqdnaaylhltsnetiegaqfkafpdtgsvpligdmssdilsr
    pfdlnqfglvyagaqknlgpsgvtvvivredlvaespkhlptmlrydtyvknnslyntpp
    sfgiymvnevlkwieergglegvqqanrkkasliydaidqsggfyrgcvdvdsrsdmnit
    frlaseelekefvkaseqegfvglkghrsvgglrasiynavpyescealvqfmehfkrsr
    g