PDB entry 1bt4

View 1bt4 on RCSB PDB site
Description: phosphoserine aminotransferase from bacillus circulans subsp. alkalophilus
Class: transferase
Keywords: aminotransferase, pyridoxal-5'-phosphate, phosphoserine, alkaliphilic, transferase
Deposited on 1998-09-02, released 1998-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoserine aminotransferase
    Species: Bacillus circulans [TaxId:1397]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59196 (2-360)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d1bt4a1, d1bt4a2
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bt4A (A:)
    seraynfnagpaalplevleraqaefvdyqhtgmsimemshrgavyeavhneaqarllal
    lgnptgykvlfiqggastqfamipmnflkegqtanyvmtgswaskalkeakligdthvaa
    sseasnymtlpklqeiqlqdnaaylhltsnetiegaqfkafpdtgsvpligdmssdilsr
    pfdlnqfglvyagaqknlgpsgvtvvivredlvaespkhlptmlrydtyvknnslyntpp
    sfgiymvnevlkwieergglegvqqanrkkasliydaidqsggfyrgcvdvdsrsdmnit
    frlaseelekefvkaseqegfvglkghrsvgglrasiynavpyescealvqfmehfkrsr
    g