PDB entry 1bt2

View 1bt2 on RCSB PDB site
Description: catechol oxidase from ipomoea batatas (sweet potatoes) in the reduced cu(I)-cu(I) state
Class: oxidoreductase
Keywords: catechol oxidase, dicopper enzyme, ipomoea batatas, oxidoreductase
Deposited on 1998-09-02, released 1999-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.184
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (catechol oxidase)
    Species: Ipomoea batatas [TaxId:4120]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bt2a_
  • Chain 'B':
    Compound: protein (catechol oxidase)
    Species: Ipomoea batatas [TaxId:4120]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bt2b_
  • Heterogens: C2O, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bt2A (A:)
    apiqapeiskcvvppadlppgavvdnccppvasnivdyklpavttmkvrpaahtmdkdai
    akfakavelmkalpaddprnfyqqalvhcaycnggydqvnfpdqeiqvhnswlffpfhrw
    ylyfyerilgkligdpsfglpfwnwdnpggmvlpdflndstsslydsnrnqshlppvvvd
    lgyngadtdvtdqqritdnlalmykqmvtnagtaelflgkayragdapspgagsietsph
    ipihrwvgdprntnnedmgnfysagrdiafychhsnvdrmwtiwqqlagkprkrdytdsd
    wlnatflfydengqavkvrigdsldnqkmgykyaktplpwldskp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bt2A (A:)
    apiqapeiskcvvppadlppgavvdnccppvasnivdyklpavttmkvrpaahtmdkdai
    akfakavelmkalpaddprnfyqqalvhcaycnggydqvnfpdqeiqvhnswlffpfhrw
    ylyfyerilgkligdpsfglpfwnwdnpggmvlpdflndstsslydsnrnqshlppvvvd
    lgyngadtdvtdqqritdnlalmykqmvtnagtaelflgkayragdapspgagsietsph
    ipihrwvgdprntnnedmgnfysagrdiafychhsnvdrmwtiwqqlardytdsdwlnat
    flfydengqavkvrigdsldnqkmgykyaktplpwl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bt2B (B:)
    apiqapeiskcvvppadlppgavvdnccppvasnivdyklpavttmkvrpaahtmdkdai
    akfakavelmkalpaddprnfyqqalvhcaycnggydqvnfpdqeiqvhnswlffpfhrw
    ylyfyerilgkligdpsfglpfwnwdnpggmvlpdflndstsslydsnrnqshlppvvvd
    lgyngadtdvtdqqritdnlalmykqmvtnagtaelflgkayragdapspgagsietsph
    ipihrwvgdprntnnedmgnfysagrdiafychhsnvdrmwtiwqqlagkprkrdytdsd
    wlnatflfydengqavkvrigdsldnqkmgykyaktplpwldskp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bt2B (B:)
    apiqapeiskcvvppadlppgavvdnccppvasnivdyklpavttmkvrpaahtmdkdai
    akfakavelmkalpaddprnfyqqalvhcaycnggydqvnfpdqeiqvhnswlffpfhrw
    ylyfyerilgkligdpsfglpfwnwdnpggmvlpdflndstsslydsnrnqshlppvvvd
    lgyngadtdvtdqqritdnlalmykqmvtnagtaelflgkayragdapspgagsietsph
    ipihrwvgdprntnnedmgnfysagrdiafychhsnvdrmwtiwqqlardytdsdwlnat
    flfydengqavkvrigdsldnqkmgykyaktplpwl