PDB entry 1bsy

View 1bsy on RCSB PDB site
Description: structural basis of the tanford transition of bovine beta-lactoglobulin from crystal structures at three ph values; ph 7.1
Deposited on 1998-08-31, released 1999-01-27
The last revision prior to the SCOP 1.69 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.2335
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.69: d1bsy__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bsy_ (-)
  livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
  wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
  clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi